GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products
Product Details
Duck Cubes
Duck Cubes
Units in Stock
7
Brand:Pero
Product Code:DOG_PER_DUC_BIT
weight:100.0g
Product Condition:New
£5.00 inc. tax
Add to Cart
Description
High quality Duck cut up into small cubes, carefully dried to seal in the savoury flavour, resulting in a tasty and aromatic treat for your dog. Duck meat is high in fat making it great for active or sporting dogs, or even as a treat to help weight gain. Duck is also an excellent source of Omega-3 and 6 fatty acids, which helps to provide a healthy skin and coat.
  • Ingredients: 100% Duck
  • Analytical Constituents: Protein 40.80%, Fat 25.50%, Ash 1.68%, Fibre 1.10%, Moisture 6.70%.
  • Pack Size: 100g
  • Feeding Guide: Treats should be used sparingly between mealtimes. If you plan to use treats regularly make sure to adjust how much you feed at mealtimes to avoid over-feeding your four-legged friend
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------